PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.18351s0323.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 220aa    MW: 25356.3 Da    PI: 4.9553
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.18351s0323.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.2e-1962115457
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                           ++++++eq++ Le  Fe ++++  e++ +LA +lgL+ rqV vWFqNrRa++k+
  Bostr.18351s0323.1.p  62 KRKLSDEQVRMLEISFEDDHKLESERKDRLALELGLDPRQVAVWFQNRRARWKN 115
                           45899***********************************************95 PP

2HD-ZIP_I/II123.59.8e-4061152293
           HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                           +kr+ls+eqv++LE sFe ++kLe+erK +la eLgl+prqvavWFqnrRAR+k+kq+E +y++Lk+ay++++ e++rL++ev +L+e+
  Bostr.18351s0323.1.p  61 RKRKLSDEQVRMLEISFEDDHKLESERKDRLALELGLDPRQVAVWFQNRRARWKNKQVEDEYSKLKNAYENVVVEKCRLDSEVLHLKEQ 149
                           8***************************************************************************************9 PP

           HD-ZIP_I/II  91 lke 93 
                           l e
  Bostr.18351s0323.1.p 150 LYE 152
                           976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.37E-1855117IPR009057Homeodomain-like
PROSITE profilePS5007116.76356116IPR001356Homeobox domain
SMARTSM003895.3E-2059120IPR001356Homeobox domain
CDDcd000861.55E-1761117No hitNo description
PfamPF000461.3E-1662115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-2063123IPR009057Homeodomain-like
PRINTSPR000313.6E-58796IPR000047Helix-turn-helix motif
PROSITE patternPS00027091114IPR017970Homeobox, conserved site
PRINTSPR000313.6E-596112IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MNNQNVDDHN LLLISQLYPD VYTPLVPQQA GEAKPARRRK RKTKSVAVAE EGGDGGNGWF  60
RKRKLSDEQV RMLEISFEDD HKLESERKDR LALELGLDPR QVAVWFQNRR ARWKNKQVED  120
EYSKLKNAYE NVVVEKCRLD SEVLHLKEQL YEAEREIQRL AQRVEGTLSN SPISSSVTVE  180
ANHATPFFGD YDISVDVDGE NLLYSPDYID GLEWMSQFI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108116RRARWKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935530.0AB493553.1 Arabidopsis thaliana At2g18550 mRNA for hypothetical protein, partial cds, clone: RAAt2g18550.
GenBankBT0313620.0BT031362.1 Arabidopsis thaliana unknown protein (At2g18550) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298526.11e-147hypothetical protein CARUB_v10014603mg
SwissprotQ9ZU701e-146ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLR0HNW11e-147R0HNW1_9BRAS; Uncharacterized protein
STRINGAT2G18550.11e-143(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22082677
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.11e-137homeobox protein 21